PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G14120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 25936.5 Da    PI: 6.5141
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G14120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.71.8e-241059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rien+  rqvtfskRr g+lKKA+E+ vLCd++va i+fs +g+l+ y+s
  ORUFI12G14120.1 10 RIENEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYAS 59
                     8**********************************************986 PP

2K-box68.91.7e-23931731696
            K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      s++ ++ kL+ +ie L+r+qR+l+G++L+sL+l+++qqLe+q+++sl++iRs+K++ll+e+   l kk  el+  ++++r+
  ORUFI12G14120.1  93 SMSYDHIKLRGKIEALKRSQRNLMGQELDSLTLQDIQQLEDQIDTSLNNIRSRKEKLLMEKNTILEKKITELETLHTSIRA 173
                      6888999*******************************************************************9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.819161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-28284IPR002100Transcription factor, MADS-box
CDDcd002657.48E-36275No hitNo description
PRINTSPR004043.8E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.93891184IPR002487Transcription factor, K-box
PfamPF014865.4E-1893170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRGKVKVRR IENEVSRQVT FSKRRPGLLK KAHEIAVLCD VDVAAIVFSA KGNLFHYASS  60
HTTMERILEK YDRHELLSEG NNVIEEFPEL EGSMSYDHIK LRGKIEALKR SQRNLMGQEL  120
DSLTLQDIQQ LEDQIDTSLN NIRSRKEKLL MEKNTILEKK ITELETLHTS IRASPTEAAA  180
PPACNTADAF VPNLNICCGD SGEPETVTAP LGWTSSNNGL PWWMLQSSSN C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-20174172Myocyte-specific enhancer factor 2B
1tqe_Q9e-20174172Myocyte-specific enhancer factor 2B
1tqe_R9e-20174172Myocyte-specific enhancer factor 2B
1tqe_S9e-20174172Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2500750.0AY250075.1 Oryza sativa (japonica cultivar-group) MADS20 (MADS20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619865.11e-168PREDICTED: MADS-box transcription factor 20
SwissprotQ2QQA31e-170MAD20_ORYSJ; MADS-box transcription factor 20
TrEMBLA0A0E0RHL11e-173A0A0E0RHL1_ORYRU; Uncharacterized protein
STRINGORGLA12G0116000.11e-167(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP146432121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-46AGAMOUS-like 8